PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YR6Y7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family bHLH
Protein Properties Length: 253aa    MW: 29147.3 Da    PI: 6.7515
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YR6Y7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH39.21.3e-1253102455
                  HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH   4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                  +hn+ Er RR++iN  ++ Lr++lP a   + kK+s  ++  ++ +YI +Lq
  Araip.YR6Y7  53 NHNASERHRRKKINALYSSLRSILPVA--DQTKKMSIPATISRVLKYIPELQ 102
                  8*************************6..48888***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474595.5E-1649119IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.62449101IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.28E-1050106No hitNo description
Gene3DG3DSA:4.10.280.103.7E-1251115IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.3E-1053102IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.5E-1055107IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010106Biological Processcellular response to iron ion starvation
GO:0055072Biological Processiron ion homeostasis
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSMILALSSP TSMFPNNMEW PLELEEEELS HSHEYFNSEE YPLLSSSMAK KFNHNASERH  60
RRKKINALYS SLRSILPVAD QTKKMSIPAT ISRVLKYIPE LQQQVEELIK KKEELLLRIS  120
RQGDINNDDA AMNKKGHHHH NSSAFLVSSS RISDSEVSIH MISSYGIQKC QVSEILVCLE  180
NHYALQLLNA SSFDTFGGRL FYNLHFQMEM AHTLDTEVLS EKILSICEKH QRIYLCNVNI  240
IIFSFFSHSI LID
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016205074.11e-171PREDICTED: transcription factor bHLH100-like isoform X1
TrEMBLA0A151RUV63e-72A0A151RUV6_CAJCA; Transcription factor ORG2
STRINGGLYMA03G28630.18e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24023379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41240.17e-28basic helix-loop-helix protein 100